WhatsAPP:8615858145714 Email:fandachem@Gmail.com

cas 75976-10-2 PANCREATIC POLYPEPTIDE, HUMAN

buy cas 75976-10-2 PANCREATIC POLYPEPTIDE, HUMAN manufacturer FandaChem supplier buy price order USD$ purchase for sale kaufen comprar acquistare acheter Email fandachem@gmail.com Mobile whatsapp wechat 0086-15858145714

  • Product namePANCREATIC POLYPEPTIDE, HUMAN
  • CAS Number75976-10-2
  • Molecular FormulaC185H287N53O54S2
  • Formula Weight4181.71098
  • SynonymsM.W. 4181.71 C185H287N53O54S2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2;ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2;ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2 HUMAN;PP, HUMAN;PANCREATIC POLYPEPTIDE
  • Contact us

    E-mail: fandachem@gmail.com ; Mobile / Whatsapp /Wechat: 0086-158-5814-5714

  • Keywords

    buy cas 75976-10-2 PANCREATIC POLYPEPTIDE, HUMAN manufacturer China,purchase price cost order,supplier distributor

Contact Form

7 x 24 Hour Serivce, Our Goal is to Provide Customers with Excellent Support and Service.

    Related products

    Custom Synthesis New Products Products About Us Home Contact us Blog